Lineage for d3ubne_ (3ubn E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775713Domain d3ubne_: 3ubn E: [186212]
    Other proteins in same PDB: d3ubnb_, d3ubnd_, d3ubnf_, d3ubnh_, d3ubnj_, d3ubnk2, d3ubnl_
    automated match to d1ruyh_
    complexed with nag

Details for d3ubne_

PDB Entry: 3ubn (more details), 2.51 Å

PDB Description: influenza hemagglutinin from the 2009 pandemic in complex with ligand 6sln
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d3ubne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubne_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnips

SCOPe Domain Coordinates for d3ubne_:

Click to download the PDB-style file with coordinates for d3ubne_.
(The format of our PDB-style files is described here.)

Timeline for d3ubne_: