Lineage for d3u8np_ (3u8n P:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965334Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 965335Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) (S)
  5. 965336Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
  6. 965389Protein automated matches [190922] (2 species)
    not a true protein
  7. 965390Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (7 PDB entries)
  8. 965426Domain d3u8np_: 3u8n P: [186187]
    automated match to d1uw6a_
    complexed with 09s, nag, so4

Details for d3u8np_

PDB Entry: 3u8n (more details), 2.35 Å

PDB Description: crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3950 (1-(6-bromo-5-ethoxypyridin- 3-yl)-1,4-diazepane)
PDB Compounds: (P:) acetylcholine-binding protein

SCOPe Domain Sequences for d3u8np_:

Sequence, based on SEQRES records: (download)

>d3u8np_ b.96.1.1 (P:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkgrs

Sequence, based on observed residues (ATOM records): (download)

>d3u8np_ b.96.1.1 (P:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkkgrs

SCOPe Domain Coordinates for d3u8np_:

Click to download the PDB-style file with coordinates for d3u8np_.
(The format of our PDB-style files is described here.)

Timeline for d3u8np_: