Lineage for d3u8mn_ (3u8m N:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408112Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2408206Protein automated matches [190922] (2 species)
    not a true protein
  7. 2408207Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (33 PDB entries)
  8. 2408371Domain d3u8mn_: 3u8m N: [186165]
    automated match to d1uw6a_
    complexed with 09r, so4

Details for d3u8mn_

PDB Entry: 3u8m (more details), 2.7 Å

PDB Description: crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3920 (1-(6-bromopyridin-3-yl)-1, 4-diazepane)
PDB Compounds: (N:) acetylcholine-binding protein

SCOPe Domain Sequences for d3u8mn_:

Sequence, based on SEQRES records: (download)

>d3u8mn_ b.96.1.1 (N:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d3u8mn_ b.96.1.1 (N:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeildvtqkknsv
tysccpeayedvevslnfrkk

SCOPe Domain Coordinates for d3u8mn_:

Click to download the PDB-style file with coordinates for d3u8mn_.
(The format of our PDB-style files is described here.)

Timeline for d3u8mn_: