Lineage for d3u8mh_ (3u8m H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073887Protein automated matches [190922] (2 species)
    not a true protein
  7. 2073888Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)
  8. 2074040Domain d3u8mh_: 3u8m H: [186159]
    automated match to d1uw6a_
    complexed with 09r, so4

Details for d3u8mh_

PDB Entry: 3u8m (more details), 2.7 Å

PDB Description: Crystal structure of the acetylcholine binding protein (AChBP) from Lymnaea stagnalis in complex with NS3920 (1-(6-bromopyridin-3-yl)-1,4-diazepane)
PDB Compounds: (H:) acetylcholine-binding protein

SCOPe Domain Sequences for d3u8mh_:

Sequence, based on SEQRES records: (download)

>d3u8mh_ b.96.1.1 (H:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d3u8mh_ b.96.1.1 (H:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpteyfsqysrfeildvtqkknsvtysc
cpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3u8mh_:

Click to download the PDB-style file with coordinates for d3u8mh_.
(The format of our PDB-style files is described here.)

Timeline for d3u8mh_: