Lineage for d1besa_ (1bes A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2328271Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2328272Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2328364Domain d1besa_: 1bes A: [18612]
    complexed with cl, hem, mes

Details for d1besa_

PDB Entry: 1bes (more details), 2 Å

PDB Description: interaction between proximal and distals regions of cytochrome c peroxidase
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1besa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1besa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpygaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d1besa_:

Click to download the PDB-style file with coordinates for d1besa_.
(The format of our PDB-style files is described here.)

Timeline for d1besa_: