Lineage for d3u8jg_ (3u8j G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1810674Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1810768Protein automated matches [190922] (3 species)
    not a true protein
  7. 1810769Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (19 PDB entries)
  8. 1810840Domain d3u8jg_: 3u8j G: [186118]
    automated match to d1uw6a_
    complexed with 09o, nag, so4

Details for d3u8jg_

PDB Entry: 3u8j (more details), 2.35 Å

PDB Description: Crystal structure of the acetylcholine binding protein (AChBP) from Lymnaea stagnalis in complex with NS3531 (1-(pyridin-3-yl)-1,4-diazepane)
PDB Compounds: (G:) acetylcholine-binding protein

SCOPe Domain Sequences for d3u8jg_:

Sequence, based on SEQRES records: (download)

>d3u8jg_ b.96.1.1 (G:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d3u8jg_ b.96.1.1 (G:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrpvavsvslkfinilevneitnevdvvfwqqttwsdrt
lawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrfs
cdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkns
vtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3u8jg_:

Click to download the PDB-style file with coordinates for d3u8jg_.
(The format of our PDB-style files is described here.)

Timeline for d3u8jg_: