SCOPe 2.05: Domain d1ccca_: 1ccc A:

Lineage for d1ccca_ (1ccc A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (176 PDB entries)
   Uniprot P00431

8. Domain d1ccca_: 1ccc A: [18611]
   complexed with hem

Details for d1ccca_

PDB Entry: 1ccc, 2 Å

PDB Description: the asp-his-fe triad of cytochrome c peroxidase controls the reduction potential, electronic structure, and coupling of the tryptophan free- radical to the heme

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1ccca_:

Sequence; same for both SEQRES and ATOM records:

>d1ccca_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptaysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1ccca_:

• d1ccca_ first appeared (with stable ids) in SCOP 1.55, called d1ccc__
  
• d1ccca_ appears in SCOPe 2.04
  
• d1ccca_ appears in SCOPe 2.06
  
• d1ccca_ appears in the current release, SCOPe 2.08