Lineage for d3u8ea_ (3u8e A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015509Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1015510Protein automated matches [190230] (9 species)
    not a true protein
  7. 1015517Species Crocus sativus [TaxId:82528] [189777] (1 PDB entry)
  8. 1015518Domain d3u8ea_: 3u8e A: [186108]
    automated match to d1s4va_
    complexed with gol, na, so4

Details for d3u8ea_

PDB Entry: 3u8e (more details), 1.31 Å

PDB Description: Crystal Structure of Cysteine Protease from Bulbs of Crocus sativus at 1.3 A Resolution
PDB Compounds: (A:) Papain-like Cysteine Protease

SCOPe Domain Sequences for d3u8ea_:

Sequence, based on SEQRES records: (download)

>d3u8ea_ d.3.1.0 (A:) automated matches {Crocus sativus [TaxId: 82528]}
apasidwrkkgavtsvkdqgacgmcwafgatgaiegidaittgrlisvseqqivdcdtxx
xxxxggdaddafrwvitnggiasdanypytgvdgtcdlnkpiaaridgytnvpnsssall
davakqpvsvniytsstsfqlytgpgifagsscsddpatvdhtvlivgygsngtnadywi
vknswgtewgidgyilirrntnrpdgvcaidawgsyptksts

Sequence, based on observed residues (ATOM records): (download)

>d3u8ea_ d.3.1.0 (A:) automated matches {Crocus sativus [TaxId: 82528]}
apasidwrkkgavtsvkdqgacgmcwafgatgaiegidaittgrlisvseqqivdcdtgg
daddafrwvitnggiasdanypytgvdgtcdlnkpiaaridgytnvpnsssalldavakq
pvsvniytsstsfqlytgpgifagsscsddpatvdhtvlivgygsngtnadywivknswg
tewgidgyilirrntnrpdgvcaidawgsyptksts

SCOPe Domain Coordinates for d3u8ea_:

Click to download the PDB-style file with coordinates for d3u8ea_.
(The format of our PDB-style files is described here.)

Timeline for d3u8ea_: