![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Crocus sativus [TaxId:82528] [189777] (1 PDB entry) |
![]() | Domain d3u8ea_: 3u8e A: [186108] automated match to d1s4va_ complexed with gol, na, so4 |
PDB Entry: 3u8e (more details), 1.31 Å
SCOPe Domain Sequences for d3u8ea_:
Sequence, based on SEQRES records: (download)
>d3u8ea_ d.3.1.0 (A:) automated matches {Crocus sativus [TaxId: 82528]} apasidwrkkgavtsvkdqgacgmcwafgatgaiegidaittgrlisvseqqivdcdtxx xxxxggdaddafrwvitnggiasdanypytgvdgtcdlnkpiaaridgytnvpnsssall davakqpvsvniytsstsfqlytgpgifagsscsddpatvdhtvlivgygsngtnadywi vknswgtewgidgyilirrntnrpdgvcaidawgsyptksts
>d3u8ea_ d.3.1.0 (A:) automated matches {Crocus sativus [TaxId: 82528]} apasidwrkkgavtsvkdqgacgmcwafgatgaiegidaittgrlisvseqqivdcdtgg daddafrwvitnggiasdanypytgvdgtcdlnkpiaaridgytnvpnsssalldavakq pvsvniytsstsfqlytgpgifagsscsddpatvdhtvlivgygsngtnadywivknswg tewgidgyilirrntnrpdgvcaidawgsyptksts
Timeline for d3u8ea_: