SCOPe 2.08: Domain d3u8ea_: 3u8e A:

Lineage for d3u8ea_ (3u8e A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Crocus sativus [TaxId:82528] [189777] (1 PDB entry)

8. Domain d3u8ea_: 3u8e A: [186108]
   automated match to d1s4va_
   complexed with gol, na, so4

Details for d3u8ea_

PDB Entry: 3u8e, 1.31 Å

PDB Description: Crystal Structure of Cysteine Protease from Bulbs of Crocus sativus at 1.3 A Resolution

PDB Compounds: (A:) Papain-like Cysteine Protease

SCOPe Domain Sequences for d3u8ea_:

Sequence, based on SEQRES records:

>d3u8ea_ d.3.1.0 (A:) automated matches {Crocus sativus [TaxId: 82528]}
apasidwrkkgavtsvkdqgacgmcwafgatgaiegidaittgrlisvseqqivdcdtxx
xxxxggdaddafrwvitnggiasdanypytgvdgtcdlnkpiaaridgytnvpnsssall
davakqpvsvniytsstsfqlytgpgifagsscsddpatvdhtvlivgygsngtnadywi
vknswgtewgidgyilirrntnrpdgvcaidawgsyptksts

Sequence, based on observed residues (ATOM records):

>d3u8ea_ d.3.1.0 (A:) automated matches {Crocus sativus [TaxId: 82528]}
apasidwrkkgavtsvkdqgacgmcwafgatgaiegidaittgrlisvseqqivdcdtgg
daddafrwvitnggiasdanypytgvdgtcdlnkpiaaridgytnvpnsssalldavakq
pvsvniytsstsfqlytgpgifagsscsddpatvdhtvlivgygsngtnadywivknswg
tewgidgyilirrntnrpdgvcaidawgsyptksts

Timeline for d3u8ea_:

• d3u8ea_ first appeared in SCOPe 2.01
  
• d3u8ea_ appears in SCOPe 2.07