Lineage for d3u80b_ (3u80 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983552Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 983817Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 983818Protein automated matches [191250] (1 species)
    not a true protein
  7. 983819Species Bifidobacterium longum [TaxId:759350] [189776] (1 PDB entry)
  8. 983821Domain d3u80b_: 3u80 B: [186106]
    automated match to d1h05a_

Details for d3u80b_

PDB Entry: 3u80 (more details), 1.6 Å

PDB Description: 1.60 angstrom resolution crystal structure of a 3-dehydroquinate dehydratase-like protein from bifidobacterium longum
PDB Compounds: (B:) 3-dehydroquinate dehydratase, type II

SCOPe Domain Sequences for d3u80b_:

Sequence, based on SEQRES records: (download)

>d3u80b_ c.23.13.0 (B:) automated matches {Bifidobacterium longum [TaxId: 759350]}
mtkvivvngpnlgrlgvrqpdvygrqdldtlrklcaewgkdlglevevrqtddeaemvrw
mhqaadektpvvmnpaafthysyaladaahmvidenlplmevhisnpsardefrkrsvis
pvatgtitgmgfygyklaldavahllse

Sequence, based on observed residues (ATOM records): (download)

>d3u80b_ c.23.13.0 (B:) automated matches {Bifidobacterium longum [TaxId: 759350]}
mtkvivvngpnqdldtlrklcaewgkdlglevevrqtddeaemvrwmhqaadektpvvmn
paafthysyaladaahmvidenlplmevhisnpsarvatgtitgmgfygyklaldavahl
lse

SCOPe Domain Coordinates for d3u80b_:

Click to download the PDB-style file with coordinates for d3u80b_.
(The format of our PDB-style files is described here.)

Timeline for d3u80b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3u80a_