Lineage for d3u7sa_ (3u7s A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2408673Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2408922Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (578 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2409518Domain d3u7sa_: 3u7s A: [186103]
    automated match to d1sgua_
    complexed with 017, bme

Details for d3u7sa_

PDB Entry: 3u7s (more details), 2.05 Å

PDB Description: hiv pr drug resistant patient's variant in complex with darunavir
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d3u7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u7sa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvvvkvggqlmealldtgaddtifeemnlpgrwtpkmiggiggflnvrqyd
qvpieicghkvvstvligptplnvigrnvmtqigctlnf

SCOPe Domain Coordinates for d3u7sa_:

Click to download the PDB-style file with coordinates for d3u7sa_.
(The format of our PDB-style files is described here.)

Timeline for d3u7sa_: