![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.14: Glycogenin [75273] (2 proteins) |
![]() | Protein Glycogenin [75274] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189634] (14 PDB entries) |
![]() | Domain d3u2xb1: 3u2x B:1-262 [186072] Other proteins in same PDB: d3u2xa2, d3u2xb2 automated match to d1ll0a_ complexed with aso, edo, mn, udp |
PDB Entry: 3u2x (more details), 1.77 Å
SCOPe Domain Sequences for d3u2xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u2xb1 c.68.1.14 (B:1-262) Glycogenin {Human (Homo sapiens) [TaxId: 9606]} mtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevim vdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdreel saapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdir khlpfiynlssisiysylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpnm thpeflilwwnifttnvlpllq
Timeline for d3u2xb1: