Lineage for d3u2xa1 (3u2x A:1-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899110Family c.68.1.14: Glycogenin [75273] (2 proteins)
  6. 2899111Protein Glycogenin [75274] (2 species)
  7. 2899112Species Human (Homo sapiens) [TaxId:9606] [189634] (14 PDB entries)
  8. 2899124Domain d3u2xa1: 3u2x A:1-262 [186071]
    Other proteins in same PDB: d3u2xa2, d3u2xb2
    automated match to d1ll0a_
    complexed with aso, edo, mn, udp

Details for d3u2xa1

PDB Entry: 3u2x (more details), 1.77 Å

PDB Description: crystal structure of human glycogenin-1 (gyg1) complexed with manganese, udp and 1'-deoxyglucose
PDB Compounds: (A:) glycogenin-1

SCOPe Domain Sequences for d3u2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u2xa1 c.68.1.14 (A:1-262) Glycogenin {Human (Homo sapiens) [TaxId: 9606]}
mtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevim
vdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdreel
saapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdir
khlpfiynlssisiysylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpnm
thpeflilwwnifttnvlpllq

SCOPe Domain Coordinates for d3u2xa1:

Click to download the PDB-style file with coordinates for d3u2xa1.
(The format of our PDB-style files is described here.)

Timeline for d3u2xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3u2xa2