Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.14: Glycogenin [75273] (1 protein) |
Protein Glycogenin [75274] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [189634] (11 PDB entries) |
Domain d3u2ua_: 3u2u A: [186065] automated match to d1ll0a_ complexed with gol, mn, so4, udp |
PDB Entry: 3u2u (more details), 1.45 Å
SCOPe Domain Sequences for d3u2ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u2ua_ c.68.1.14 (A:) Glycogenin {Human (Homo sapiens) [TaxId: 9606]} smtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevi mvdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdree lsaapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdi rkhlpfiynlssisiysylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpn mthpeflilwwnifttnvlpllq
Timeline for d3u2ua_: