SCOPe 2.01: Domain d3u2ua_: 3u2u A:

Lineage for d3u2ua_ (3u2u A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.14: Glycogenin [75273] (1 protein)

6. Protein Glycogenin [75274] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [189634] (11 PDB entries)

8. Domain d3u2ua_: 3u2u A: [186065]
   automated match to d1ll0a_
   complexed with gol, mn, so4, udp

Details for d3u2ua_

PDB Entry: 3u2u, 1.45 Å

PDB Description: crystal structure of human glycogenin-1 (gyg1) complexed with manganese, udp and maltotetraose

PDB Compounds: (A:) glycogenin-1

SCOPe Domain Sequences for d3u2ua_:

Sequence; same for both SEQRES and ATOM records:

>d3u2ua_ c.68.1.14 (A:) Glycogenin {Human (Homo sapiens) [TaxId: 9606]}
smtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevi
mvdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdree
lsaapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdi
rkhlpfiynlssisiysylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpn
mthpeflilwwnifttnvlpllq

Timeline for d3u2ua_:

• d3u2ua_ is new in SCOPe 2.01-stable
  
• d3u2ua_ appears in SCOPe 2.02
  
• d3u2ua_ appears in the current release, SCOPe 2.08, called d3u2ua1