| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
| Family a.21.1.1: HMG-box [47096] (10 proteins) |
| Protein automated matches [190434] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188832] (3 PDB entries) |
| Domain d3u2bc_: 3u2b C: [186063] automated match to d1gt0d_ protein/DNA complex |
PDB Entry: 3u2b (more details), 2.4 Å
SCOPe Domain Sequences for d3u2bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u2bc_ a.21.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghikrpmnafmvwsqierrkimeqspdmhnaeiskrlgkrwkllkdsdkipfiqeaerlr
lkhmadypdykyrprk
Timeline for d3u2bc_: