Lineage for d3u2bc_ (3u2b C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2698017Protein automated matches [190434] (3 species)
    not a true protein
  7. 2698032Species Mouse (Mus musculus) [TaxId:10090] [188832] (3 PDB entries)
  8. 2698033Domain d3u2bc_: 3u2b C: [186063]
    automated match to d1gt0d_
    protein/DNA complex

Details for d3u2bc_

PDB Entry: 3u2b (more details), 2.4 Å

PDB Description: Structure of the Sox4 HMG domain bound to DNA
PDB Compounds: (C:) Transcription factor SOX-4

SCOPe Domain Sequences for d3u2bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u2bc_ a.21.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghikrpmnafmvwsqierrkimeqspdmhnaeiskrlgkrwkllkdsdkipfiqeaerlr
lkhmadypdykyrprk

SCOPe Domain Coordinates for d3u2bc_:

Click to download the PDB-style file with coordinates for d3u2bc_.
(The format of our PDB-style files is described here.)

Timeline for d3u2bc_: