SCOPe 2.08: Domain d3u28b_: 3u28 B:

Lineage for d3u28b_ (3u28 B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)
   automatically mapped to Pfam PF04135

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein H/aca ribonucleoprotein complex subunit 3 [144212] (1 species)
   lacks the zinc-binding site, mostly unstructured

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144213] (4 PDB entries)
   Uniprot Q6Q547 2-58

8. Domain d3u28b_: 3u28 B: [186062]
   automated match to d1y2ya1
   protein/RNA complex

Details for d3u28b_

PDB Entry: 3u28, 1.9 Å

PDB Description: Crystal structure of a Cbf5-Nop10-Gar1 complex from Saccharomyces cerevisiae

PDB Compounds: (B:) H/ACA ribonucleoprotein complex subunit 3

SCOPe Domain Sequences for d3u28b_:

Sequence; same for both SEQRES and ATOM records:

>d3u28b_ g.41.16.1 (B:) H/aca ribonucleoprotein complex subunit 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtl

Timeline for d3u28b_:

• d3u28b_ first appeared in SCOPe 2.01
  
• d3u28b_ appears in SCOPe 2.07