SCOPe 2.05: Domain d3u26a_: 3u26 A:

Lineage for d3u26a_ (3u26 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.1: HAD-related [56785] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein automated matches [191260] (1 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [189820] (2 PDB entries)

8. Domain d3u26a_: 3u26 A: [186061]
   automated match to d1x42a1

Details for d3u26a_

PDB Entry: 3u26, 1.59 Å

PDB Description: crystal structure of engineered protein. northeast structural genomics consortium target or48

PDB Compounds: (A:) PF00702 domain protein

SCOPe Domain Sequences for d3u26a_:

Sequence; same for both SEQRES and ATOM records:

>d3u26a_ c.108.1.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
miravffdslgtlnsvegaakshlkimeevlgdyplnpktlldeyekltreafsnyagkp
yrplrdileevmrklaekygfkypenfweislrmsqrygelypevvevlkslkgkyhvgm
itdsdteqamafldalgikdlfdsittseeagffkphprifelalkkagvkgeeavyvgd
npvkdcggsknlgmtsilldrkgekrefwdkcdfivsdlrevikivdeln

Timeline for d3u26a_:

• d3u26a_ first appeared in SCOPe 2.01
  
• d3u26a_ appears in SCOPe 2.04
  
• d3u26a_ is called d3u26a1 in SCOPe 2.06
  
• d3u26a_ appears in the current release, SCOPe 2.08, called d3u26a1