Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.1: HAD-related [56785] (3 proteins) the insertion subdomain is a 4-helical bundle |
Protein automated matches [191260] (1 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [189820] (2 PDB entries) |
Domain d3u26a_: 3u26 A: [186061] automated match to d1x42a1 |
PDB Entry: 3u26 (more details), 1.59 Å
SCOPe Domain Sequences for d3u26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u26a_ c.108.1.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} miravffdslgtlnsvegaakshlkimeevlgdyplnpktlldeyekltreafsnyagkp yrplrdileevmrklaekygfkypenfweislrmsqrygelypevvevlkslkgkyhvgm itdsdteqamafldalgikdlfdsittseeagffkphprifelalkkagvkgeeavyvgd npvkdcggsknlgmtsilldrkgekrefwdkcdfivsdlrevikivdeln
Timeline for d3u26a_: