Lineage for d3u1jb_ (3u1j B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1547302Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1547303Protein NS3 protease [50600] (5 species)
  7. 1547304Species Dengue virus 3 [TaxId:408693] [189803] (2 PDB entries)
  8. 1547305Domain d3u1jb_: 3u1j B: [186057]
    Other proteins in same PDB: d3u1je_
    automated match to d1befa_

Details for d3u1jb_

PDB Entry: 3u1j (more details), 1.8 Å

PDB Description: Aprotinin bound to Dengue virus protease
PDB Compounds: (B:) Serine protease NS3

SCOPe Domain Sequences for d3u1jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u1jb_ b.47.1.3 (B:) NS3 protease {Dengue virus 3 [TaxId: 408693]}
dvpsppetqkaeleegvyrikqqgifgktqvgvgvqkegvfhtmwhvtrgavlthngkrl
epnwasvkkdlisygggwrlsaqwqkgeevqviavepgknpknfqtmpgtfqtttgeiga
ialdfkpgtsgspiinregkvvglygngvvtknggyvsgiaqtnae

SCOPe Domain Coordinates for d3u1jb_:

Click to download the PDB-style file with coordinates for d3u1jb_.
(The format of our PDB-style files is described here.)

Timeline for d3u1jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3u1je_