Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NS3 protease [50600] (5 species) |
Species Dengue virus 3 [TaxId:408693] [189803] (2 PDB entries) |
Domain d3u1jb_: 3u1j B: [186057] Other proteins in same PDB: d3u1je_ automated match to d1befa_ |
PDB Entry: 3u1j (more details), 1.8 Å
SCOPe Domain Sequences for d3u1jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u1jb_ b.47.1.3 (B:) NS3 protease {Dengue virus 3 [TaxId: 408693]} dvpsppetqkaeleegvyrikqqgifgktqvgvgvqkegvfhtmwhvtrgavlthngkrl epnwasvkkdlisygggwrlsaqwqkgeevqviavepgknpknfqtmpgtfqtttgeiga ialdfkpgtsgspiinregkvvglygngvvtknggyvsgiaqtnae
Timeline for d3u1jb_: