Lineage for d3u11b_ (3u11 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963689Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 963695Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 963801Protein automated matches [190352] (5 species)
    not a true protein
  7. 963802Species Human (Homo sapiens) [TaxId:9606] [189505] (3 PDB entries)
  8. 963805Domain d3u11b_: 3u11 B: [186054]
    automated match to d1q5oa_
    complexed with cmp, gol

Details for d3u11b_

PDB Entry: 3u11 (more details), 2.5 Å

PDB Description: Tetramerization dynamics of the C-terminus underlies isoform-specific cAMP-gating in HCN channels
PDB Compounds: (B:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d3u11b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u11b_ b.82.3.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaldrldrigkknsill

SCOPe Domain Coordinates for d3u11b_:

Click to download the PDB-style file with coordinates for d3u11b_.
(The format of our PDB-style files is described here.)

Timeline for d3u11b_: