Lineage for d3u0ia_ (3u0i A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055435Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2055436Protein automated matches [190439] (20 species)
    not a true protein
  7. 2055451Species Brucella melitensis [TaxId:359391] [189754] (2 PDB entries)
  8. 2055453Domain d3u0ia_: 3u0i A: [186049]
    automated match to d2hq9a1
    complexed with edo, nhe

Details for d3u0ia_

PDB Entry: 3u0i (more details), 2.2 Å

PDB Description: crystal structure of a probable fad-binding, putative uncharacterized protein from brucella melitensis
PDB Compounds: (A:) probable FAD-binding, putative uncharacterized protein

SCOPe Domain Sequences for d3u0ia_:

Sequence, based on SEQRES records: (download)

>d3u0ia_ b.45.1.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]}
litemsdydiremiqhkhvgrlgyvvddrpiivpmtfrfsggsfysfttdgqktnamrkn
daicilfdqiesqtkwrtvlvqgryreiaredeeeaivrimaneptwwepaytktitkeg
taralkpvffrvdieklsghqae

Sequence, based on observed residues (ATOM records): (download)

>d3u0ia_ b.45.1.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]}
litemsdydiremiqhkhvgrlgyvvddrpiivpmtfrfsggsfysfttdgqktnamrkn
daicilfdqiesqtkwrtvlvqgryreiaredeeeaivrimaneptwkpvffrvdiekls
ghqae

SCOPe Domain Coordinates for d3u0ia_:

Click to download the PDB-style file with coordinates for d3u0ia_.
(The format of our PDB-style files is described here.)

Timeline for d3u0ia_: