Lineage for d3u04a_ (3u04 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2607053Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2607054Protein automated matches [191055] (20 species)
    not a true protein
  7. 2607086Species Ehrlichia chaffeensis [TaxId:205920] [189753] (2 PDB entries)
  8. 2607087Domain d3u04a_: 3u04 A: [186046]
    automated match to d1n5na_
    complexed with bb2, cl, zn

Details for d3u04a_

PDB Entry: 3u04 (more details), 1.7 Å

PDB Description: crystal structure of peptide deformylase from ehrlichia chaffeensis in complex with actinonin
PDB Compounds: (A:) Peptide deformylase 1

SCOPe Domain Sequences for d3u04a_:

Sequence, based on SEQRES records: (download)

>d3u04a_ d.167.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
msvlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilv
mnvpeefedsedienvedkiegyelyggpyciinpkivdisqekvklkegclsvpgyfdy
ivrpqriavqyldyngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvk
kkert

Sequence, based on observed residues (ATOM records): (download)

>d3u04a_ d.167.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
msvlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilv
mnvpeeiegyelyggpyciinpkivdisqekvklkegclsvpgyfdyivrpqriavqyld
yngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvkkkert

SCOPe Domain Coordinates for d3u04a_:

Click to download the PDB-style file with coordinates for d3u04a_.
(The format of our PDB-style files is described here.)

Timeline for d3u04a_: