SCOPe 2.01: Domain d3u04a_: 3u04 A:

Lineage for d3u04a_ (3u04 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (3 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [189753] (1 PDB entry)

8. Domain d3u04a_: 3u04 A: [186046]
   automated match to d1n5na_
   complexed with bb2, cl, zn

Details for d3u04a_

PDB Entry: 3u04, 1.7 Å

PDB Description: crystal structure of peptide deformylase from ehrlichia chaffeensis in complex with actinonin

PDB Compounds: (A:) Peptide deformylase 1

SCOPe Domain Sequences for d3u04a_:

Sequence, based on SEQRES records:

>d3u04a_ d.167.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
msvlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilv
mnvpeefedsedienvedkiegyelyggpyciinpkivdisqekvklkegclsvpgyfdy
ivrpqriavqyldyngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvk
kkert

Sequence, based on observed residues (ATOM records):

>d3u04a_ d.167.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
msvlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilv
mnvpeeiegyelyggpyciinpkivdisqekvklkegclsvpgyfdyivrpqriavqyld
yngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvkkkert

Timeline for d3u04a_:

• d3u04a_ is new in SCOPe 2.01-stable
  
• d3u04a_ appears in SCOPe 2.02
  
• d3u04a_ appears in the current release, SCOPe 2.08