![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (3 species) not a true protein |
![]() | Species Ehrlichia chaffeensis [TaxId:205920] [189753] (1 PDB entry) |
![]() | Domain d3u04a_: 3u04 A: [186046] automated match to d1n5na_ complexed with bb2, cl, zn |
PDB Entry: 3u04 (more details), 1.7 Å
SCOPe Domain Sequences for d3u04a_:
Sequence, based on SEQRES records: (download)
>d3u04a_ d.167.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} msvlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilv mnvpeefedsedienvedkiegyelyggpyciinpkivdisqekvklkegclsvpgyfdy ivrpqriavqyldyngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvk kkert
>d3u04a_ d.167.1.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} msvlsivtvpdkrlslcseevekvdqsirklvddmfetmhanqglglaavqvgvhkrilv mnvpeeiegyelyggpyciinpkivdisqekvklkegclsvpgyfdyivrpqriavqyld yngneciikaqgwlarclqheidhlngtvflkylskfkrdfaiekvkkkert
Timeline for d3u04a_: