Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (4 species) not a true protein |
Species Rana pipiens [TaxId:8404] [188156] (3 PDB entries) |
Domain d3u01a_: 3u01 A: [186045] automated match to d1onca_ complexed with act, so4; mutant |
PDB Entry: 3u01 (more details), 1.12 Å
SCOPe Domain Sequences for d3u01a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u01a_ d.5.1.1 (A:) automated matches {Rana pipiens [TaxId: 8404]} edwltfqkkhitntrdvdcdnimstnlfhakdkntfiysrpepvkaickgiiasknvltt sefylsdcnvtsrpakyklkkstnkfcvtcenqapvhfvgvgsc
Timeline for d3u01a_: