Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Amphibian cytotoxic ribonuclease [54084] (5 species) |
Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries) |
Domain d3u00a_: 3u00 A: [186044] automated match to d1onca_ complexed with po4 |
PDB Entry: 3u00 (more details), 1.65 Å
SCOPe Domain Sequences for d3u00a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u00a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]} edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc
Timeline for d3u00a_: