SCOPe 2.05: Domain d3tztb_: 3tzt B:

Lineage for d3tztb_ (3tzt B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (23 species)
   not a true protein

7. Species Anaerococcus prevotii [TaxId:525919] [189838] (2 PDB entries)

8. Domain d3tztb_: 3tzt B: [186043]
   automated match to d1g9ra_
   complexed with cit, edo

Details for d3tztb_

PDB Entry: 3tzt, 2.1 Å

PDB Description: the structure of a protein in glycosyl transferase family 8 from anaerococcus prevotii.

PDB Compounds: (B:) Glycosyl transferase family 8

SCOPe Domain Sequences for d3tztb_:

Sequence, based on SEQRES records:

>d3tztb_ c.68.1.0 (B:) automated matches {Anaerococcus prevotii [TaxId: 525919]}
adallltldenyipqmkvlmtsiyinnpgrifdvylihsrisedklkdlgedlkkfsytl
ypiratddlfsfakvtdrypkemyyrllageflpenlgeilyldpdmlvinplddllrtd
isdyilaaashtgktdmannvnrirlgtdtdyynsglllinlkrareeidpdeifsfved
nhmnlllpdqdilnamygdriyplddliynydarnyssylirskkqadlawlmdhtvvlh
fcgrdkpwkknhrnkftslykhymsltkryla

Sequence, based on observed residues (ATOM records):

>d3tztb_ c.68.1.0 (B:) automated matches {Anaerococcus prevotii [TaxId: 525919]}
adallltldenyipqmkvlmtsiyinnpgrifdvylihsrisedklkdlgedlkkfsytl
ypiratkemyyrllageflpenlgeilyldpdmlvinplddllrtdisdyilaaashdyy
nsglllinlkrareeidpdeifsfvlpdqdilnamygdriyplddliynydarnyssyli
rskkqadlawlmdhtvvlhfcgrdkpwkknhrnkftslykhymsltkryla

Timeline for d3tztb_:

• d3tztb_ first appeared in SCOPe 2.01
  
• d3tztb_ appears in SCOPe 2.04
  
• d3tztb_ appears in SCOPe 2.06
  
• d3tztb_ appears in the current release, SCOPe 2.08