Lineage for d3tzsc_ (3tzs C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804764Protein automated matches [190163] (13 species)
    not a true protein
  7. 2804796Species Human (Homo sapiens) [TaxId:9606] [188452] (14 PDB entries)
  8. 2804822Domain d3tzsc_: 3tzs C: [186041]
    automated match to d1ngla_
    complexed with cl, edo, phu, so4; mutant

Details for d3tzsc_

PDB Entry: 3tzs (more details), 2.45 Å

PDB Description: crystal structure of neutrophil gelatinase-associated lipocalin ngal (c87s mutant) in complex with fragment 1026, phenylurea
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3tzsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzsc_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d3tzsc_:

Click to download the PDB-style file with coordinates for d3tzsc_.
(The format of our PDB-style files is described here.)

Timeline for d3tzsc_: