SCOPe 2.03: Domain d3tzsb_: 3tzs B:

Lineage for d3tzsb_ (3tzs B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188452] (10 PDB entries)

8. Domain d3tzsb_: 3tzs B: [186040]
   automated match to d1ngla_
   complexed with cl, edo, phu, so4; mutant

Details for d3tzsb_

PDB Entry: 3tzs, 2.45 Å

PDB Description: crystal structure of neutrophil gelatinase-associated lipocalin ngal (c87s mutant) in complex with fragment 1026, phenylurea

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3tzsb_:

Sequence; same for both SEQRES and ATOM records:

>d3tzsb_ b.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d3tzsb_:

• d3tzsb_ first appeared in SCOPe 2.01
  
• d3tzsb_ appears in SCOPe 2.02
  
• d3tzsb_ appears in SCOPe 2.04
  
• d3tzsb_ appears in the current release, SCOPe 2.08