Lineage for d3tzqh_ (3tzq H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847711Species Mycobacterium marinum [TaxId:216594] [189743] (2 PDB entries)
  8. 2847721Domain d3tzqh_: 3tzq H: [186038]
    automated match to d2ew8a1
    complexed with edo, gol, peg

Details for d3tzqh_

PDB Entry: 3tzq (more details), 2.5 Å

PDB Description: crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum
PDB Compounds: (H:) Short-chain type dehydrogenase/reductase

SCOPe Domain Sequences for d3tzqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzqh_ c.2.1.0 (H:) automated matches {Mycobacterium marinum [TaxId: 216594]}
aelenkvaiitgacggigletsrvlaragarvvladlpetdlagaaasvgrgavhhvvdl
tnevsvralidftidtfgrldivdnnaahsdpadmlvtqmtvdvwddtftvnargtmlmc
kyaiprlisagggaivnissatahaaydmstayactkaaietltryvatqygrhgvrcna
iapglvrtprlevglpqpivdifathhlagrigepheiaelvcflasdraafitgqviaa
dsgllahlpglpqirasvael

SCOPe Domain Coordinates for d3tzqh_:

Click to download the PDB-style file with coordinates for d3tzqh_.
(The format of our PDB-style files is described here.)

Timeline for d3tzqh_: