![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein automated matches [190068] (12 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [189873] (2 PDB entries) |
![]() | Domain d3tzob1: 3tzo B:5-404 [186031] Other proteins in same PDB: d3tzoa2, d3tzob2 automated match to d1s1fa_ complexed with hem, spm |
PDB Entry: 3tzo (more details), 1.76 Å
SCOPe Domain Sequences for d3tzob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tzob1 a.104.1.1 (B:5-404) automated matches {Streptomyces coelicolor [TaxId: 1902]} tisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvt ndprfgreavmdrqvtrlaphfkpargavgfldppdhtrlrrsvaaaftargvervrers rgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshg aevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigge avtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveik gvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarlese llvdavldrvpglklavapedvpfkkgalirgpealpvtw
Timeline for d3tzob1: