Lineage for d3tzob1 (3tzo B:5-404)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005524Species Streptomyces coelicolor [TaxId:1902] [189873] (2 PDB entries)
  8. 2005526Domain d3tzob1: 3tzo B:5-404 [186031]
    Other proteins in same PDB: d3tzoa2, d3tzob2
    automated match to d1s1fa_
    complexed with hem, spm

Details for d3tzob1

PDB Entry: 3tzo (more details), 1.76 Å

PDB Description: the role of i87 of cyp158a2 in oxidative coupling reaction
PDB Compounds: (B:) putative cytochrome P450

SCOPe Domain Sequences for d3tzob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzob1 a.104.1.1 (B:5-404) automated matches {Streptomyces coelicolor [TaxId: 1902]}
tisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvt
ndprfgreavmdrqvtrlaphfkpargavgfldppdhtrlrrsvaaaftargvervrers
rgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshg
aevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigge
avtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveik
gvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarlese
llvdavldrvpglklavapedvpfkkgalirgpealpvtw

SCOPe Domain Coordinates for d3tzob1:

Click to download the PDB-style file with coordinates for d3tzob1.
(The format of our PDB-style files is described here.)

Timeline for d3tzob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tzob2