SCOPe 2.02: Domain d3tzlb_: 3tzl B:

Lineage for d3tzlb_ (3tzl B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (18 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [189366] (3 PDB entries)

8. Domain d3tzlb_: 3tzl B: [186029]
   automated match to d1i6ka_
   protein/RNA complex; complexed with adp, na, po4, trp

Details for d3tzlb_

PDB Entry: 3tzl, 2.15 Å

PDB Description: Crystal Structure of Tryptophanyl-tRNA Synthetase from Campylobacter jejuni complexed with ADP and Tryptophane

PDB Compounds: (B:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3tzlb_:

Sequence; same for both SEQRES and ATOM records:

>d3tzlb_ c.26.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
amrvltglqpsgdlhignyfgaikqmvdaqeksqmfmfianyhamtssqdgeklkqnslk
aaaaflslgidpqksvfwlqsdvkevmelywilsqftpmgllerahsykdkvakglsash
glfsypvlmaadillfdtrivpvgkdqiqhveiardialkvnnewgeiftlpearvneev
avvvgtdgakmsksyqntidifssektlkkqissivtdstaledpkdhencnifkiaklf
ldesgqkelqiryekggegyghfkiylnelvnayfkearekynellekpshlkeildfga
tkarkiaqekmqkiyekigl

Timeline for d3tzlb_:

• d3tzlb_ first appeared in SCOPe 2.01
  
• d3tzlb_ appears in SCOPe 2.03
  
• d3tzlb_ appears in the current release, SCOPe 2.08, called d3tzlb1