Lineage for d3tzlb1 (3tzl B:1-319)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860883Species Campylobacter jejuni [TaxId:192222] [189366] (4 PDB entries)
  8. 2860886Domain d3tzlb1: 3tzl B:1-319 [186029]
    Other proteins in same PDB: d3tzlb2
    automated match to d1i6ka_
    protein/RNA complex; complexed with adp, na, po4, trp

Details for d3tzlb1

PDB Entry: 3tzl (more details), 2.15 Å

PDB Description: Crystal Structure of Tryptophanyl-tRNA Synthetase from Campylobacter jejuni complexed with ADP and Tryptophane
PDB Compounds: (B:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3tzlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzlb1 c.26.1.0 (B:1-319) automated matches {Campylobacter jejuni [TaxId: 192222]}
mrvltglqpsgdlhignyfgaikqmvdaqeksqmfmfianyhamtssqdgeklkqnslka
aaaflslgidpqksvfwlqsdvkevmelywilsqftpmgllerahsykdkvakglsashg
lfsypvlmaadillfdtrivpvgkdqiqhveiardialkvnnewgeiftlpearvneeva
vvvgtdgakmsksyqntidifssektlkkqissivtdstaledpkdhencnifkiaklfl
desgqkelqiryekggegyghfkiylnelvnayfkearekynellekpshlkeildfgat
karkiaqekmqkiyekigl

SCOPe Domain Coordinates for d3tzlb1:

Click to download the PDB-style file with coordinates for d3tzlb1.
(The format of our PDB-style files is described here.)

Timeline for d3tzlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tzlb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3tzla_