Lineage for d3tzla_ (3tzl A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 984756Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 985275Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 985276Protein automated matches [190459] (13 species)
    not a true protein
  7. 985285Species Campylobacter jejuni [TaxId:192222] [189366] (3 PDB entries)
  8. 985288Domain d3tzla_: 3tzl A: [186028]
    automated match to d1i6ka_
    protein/RNA complex; complexed with adp, na, po4, trp

Details for d3tzla_

PDB Entry: 3tzl (more details), 2.15 Å

PDB Description: Crystal Structure of Tryptophanyl-tRNA Synthetase from Campylobacter jejuni complexed with ADP and Tryptophane
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3tzla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzla_ c.26.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
mrvltglqpsgdlhignyfgaikqmvdaqeksqmfmfianyhamtssqdgeklkqnslka
aaaflslgidpqksvfwlqsdvkevmelywilsqftpmgllerahsykdkvakglsashg
lfsypvlmaadillfdtrivpvgkdqiqhveiardialkvnnewgeiftlpearvneeva
vvvgtdgakmsksyqntidifssektlkkqissivtdstaledpkdhencnifkiaklfl
desgqkelqiryekggegyghfkiylnelvnayfkearekynellekpshlkeildfgat
karkiaqekmqkiyekigl

SCOPe Domain Coordinates for d3tzla_:

Click to download the PDB-style file with coordinates for d3tzla_.
(The format of our PDB-style files is described here.)

Timeline for d3tzla_: