SCOPe 2.05: Domain d3tzbb_: 3tzb B:

Lineage for d3tzbb_ (3tzb B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (53 PDB entries)

8. Domain d3tzbb_: 3tzb B: [186018]
   automated match to d1qr2a_
   complexed with aa, fad, zn

Details for d3tzbb_

PDB Entry: 3tzb, 2.19 Å

PDB Description: Quinone Oxidoreductase (NQ02) bound to NSC13000

PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d3tzbb_:

Sequence; same for both SEQRES and ATOM records:

>d3tzbb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtlsn
pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc
qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg

Timeline for d3tzbb_:

• d3tzbb_ first appeared in SCOPe 2.01
  
• d3tzbb_ appears in SCOPe 2.04
  
• d3tzbb_ appears in SCOPe 2.06
  
• d3tzbb_ appears in the current release, SCOPe 2.08