Lineage for d3ty6a_ (3ty6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993313Species Bacillus anthracis [TaxId:198094] [189742] (1 PDB entry)
  8. 2993314Domain d3ty6a_: 3ty6 A: [186007]
    automated match to d1yyfc1
    complexed with so4

Details for d3ty6a_

PDB Entry: 3ty6 (more details), 2.5 Å

PDB Description: atp-dependent protease hslv from bacillus anthracis str. ames
PDB Compounds: (A:) ATP-dependent protease subunit HslV

SCOPe Domain Sequences for d3ty6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ty6a_ d.153.1.4 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
nfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaft
lfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviep
ddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel

SCOPe Domain Coordinates for d3ty6a_:

Click to download the PDB-style file with coordinates for d3ty6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ty6a_: