SCOPe 2.02: Domain d3ty4b_: 3ty4 B:

Lineage for d3ty4b_ (3ty4 B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (14 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [189802] (2 PDB entries)

8. Domain d3ty4b_: 3ty4 B: [186006]
   automated match to d1wpwa_
   complexed with gol

Details for d3ty4b_

PDB Entry: 3ty4, 1.55 Å

PDB Description: crystal structure of homoisocitrate dehydrogenase from schizosaccharomyces pombe

PDB Compounds: (B:) Probable homoisocitrate dehydrogenase

SCOPe Domain Sequences for d3ty4b_:

Sequence; same for both SEQRES and ATOM records:

>d3ty4b_ c.77.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
trrivlglipadgigkevvpaarrlmenlpakhklkfdfidldagwgtfertgkalpert
verlktecnaalfgavqspthkvagysspivalrkkmglyanvrpvksldgakgkpvdlv
ivrenteclyvkeermvqntpgkrvaeairriseeastkigkmafeiaksrqkiresgty
sihkkplvtiihksnvmsvtdglfrescrhaqsldpsyasinvdeqivdsmvyrlfrepe
cfdvvvapnlygdilsdgaasligslglvpsanvgdnfvmsepvhgsapdiagrgianpv
atfrsvalmlefmghqdaaadiytavdkvltegkvltpdlggksgtneitdavlani

Timeline for d3ty4b_:

• d3ty4b_ first appeared in SCOPe 2.01
  
• d3ty4b_ appears in SCOPe 2.03
  
• d3ty4b_ appears in the current release, SCOPe 2.08