Lineage for d3ty3a_ (3ty3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906396Species Schizosaccharomyces pombe [TaxId:284812] [189802] (2 PDB entries)
  8. 2906399Domain d3ty3a_: 3ty3 A: [186003]
    automated match to d1wpwa_
    complexed with ggg, gol

Details for d3ty3a_

PDB Entry: 3ty3 (more details), 1.85 Å

PDB Description: crystal structure of homoisocitrate dehydrogenase from schizosaccharomyces pombe bound to glycyl-glycyl-glycine
PDB Compounds: (A:) Probable homoisocitrate dehydrogenase

SCOPe Domain Sequences for d3ty3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ty3a_ c.77.1.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
rrivlglipadgigkevvpaarrlmenlpakhklkfdfidldagwgtfertgkalpertv
erlktecnaalfgavqspthkvagysspivalrkkmglyanvrpvksldgakgkpvdlvi
vrenteclyvkeermvqntpgkrvaeairriseeastkigkmafeiaksrqkiresgtys
ihkkplvtiihksnvmsvtdglfrescrhaqsldpsyasinvdeqivdsmvyrlfrepec
fdvvvapnlygdilsdgaasligslglvpsanvgdnfvmsepvhgsapdiagrgianpva
tfrsvalmlefmghqdaaadiytavdkvltegkvltpdlggksgtneitdavlanihn

SCOPe Domain Coordinates for d3ty3a_:

Click to download the PDB-style file with coordinates for d3ty3a_.
(The format of our PDB-style files is described here.)

Timeline for d3ty3a_: