| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.106: SurE-like [64166] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7 |
Superfamily c.106.1: SurE-like [64167] (2 families) ![]() some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family |
| Family c.106.1.0: automated matches [191430] (1 protein) not a true family |
| Protein automated matches [190619] (3 species) not a true protein |
| Species Coxiella burnetii [TaxId:777] [189767] (1 PDB entry) |
| Domain d3ty2a_: 3ty2 A: [186001] automated match to d1ilva_ complexed with trs |
PDB Entry: 3ty2 (more details), 1.89 Å
SCOPe Domain Sequences for d3ty2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ty2a_ c.106.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
klrlllsnddgvyakglailaktladlgevdvvapdrnrsgasnsltlnaplhiknleng
misvegtptdcvhlaitgvlpempdmvvaginagpnlgddvwysgtvaaamegrflglpa
lavslggelfryyetaakvvyqliqriekdplppstilninvpdlpyeelkgfevtrlgt
rhraeptirqidprghpiywvgaagpeqdsgpgtdffamnhhcvsitplrvdlthyeafd
qlaswvkrlem
Timeline for d3ty2a_: