SCOPe 2.08: Domain d3ty0b1: 3ty0 B:703-977

Lineage for d3ty0b1 (3ty0 B:703-977)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48525] (172 PDB entries)
   Uniprot P37231 232-505

8. Domain d3ty0b1: 3ty0 B:703-977 [186000]
   Other proteins in same PDB: d3ty0a2, d3ty0b2
   automated match to d1wm0x_
   complexed with 082

Details for d3ty0b1

PDB Entry: 3ty0, 2 Å

PDB Description: structure of ppargamma ligand binding domain in complex with (r)-5-(3- ((3-(6-methoxybenzo[d]isoxazol-3-yl)-2-oxo-2,3-dihydro-1h- benzo[d]imidazol-1-yl)methyl)phenyl)-5-methyloxazolidine-2,4-dione

PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3ty0b1:

Sequence; same for both SEQRES and ATOM records:

>d3ty0b1 a.123.1.1 (B:703-977) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
rqivtehvqllqvikktetdmslhpllqeiykdly

Timeline for d3ty0b1:

• d3ty0b1 first appeared in SCOPe 2.01, called d3ty0b_
  
• d3ty0b1 appears in SCOPe 2.07