Lineage for d3ty0a1 (3ty0 A:203-477)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728976Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2728977Species Human (Homo sapiens) [TaxId:9606] [48525] (172 PDB entries)
    Uniprot P37231 232-505
  8. 2729086Domain d3ty0a1: 3ty0 A:203-477 [185999]
    Other proteins in same PDB: d3ty0a2, d3ty0b2
    automated match to d1wm0x_
    complexed with 082

Details for d3ty0a1

PDB Entry: 3ty0 (more details), 2 Å

PDB Description: structure of ppargamma ligand binding domain in complex with (r)-5-(3- ((3-(6-methoxybenzo[d]isoxazol-3-yl)-2-oxo-2,3-dihydro-1h- benzo[d]imidazol-1-yl)methyl)phenyl)-5-methyloxazolidine-2,4-dione
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3ty0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ty0a1 a.123.1.1 (A:203-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
rqivtehvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d3ty0a1:

Click to download the PDB-style file with coordinates for d3ty0a1.
(The format of our PDB-style files is described here.)

Timeline for d3ty0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ty0a2