Lineage for d3tx9a_ (3tx9 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091324Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2091639Protein Old yellow enzyme (OYE) [51401] (2 species)
  7. 2091640Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [51402] (20 PDB entries)
  8. 2091655Domain d3tx9a_: 3tx9 A: [185996]
    automated match to d1k02a_
    complexed with 3rn, fmn, mg

Details for d3tx9a_

PDB Entry: 3tx9 (more details), 2 Å

PDB Description: OYE1 complexed with 2-(Hydroxymethyl)-cyclopent-2-enone
PDB Compounds: (A:) nadph dehydrogenase 1

SCOPe Domain Sequences for d3tx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tx9a_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlwvlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk

SCOPe Domain Coordinates for d3tx9a_:

Click to download the PDB-style file with coordinates for d3tx9a_.
(The format of our PDB-style files is described here.)

Timeline for d3tx9a_: