Lineage for d3tx7a_ (3tx7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332677Protein beta-Catenin [48373] (2 species)
  7. 2332678Species Human (Homo sapiens) [TaxId:9606] [48375] (10 PDB entries)
    Uniprot P35222 145-664
  8. 2332688Domain d3tx7a_: 3tx7 A: [185995]
    Other proteins in same PDB: d3tx7b_
    automated match to d1g3ja_
    complexed with p6l

Details for d3tx7a_

PDB Entry: 3tx7 (more details), 2.76 Å

PDB Description: Crystal structure of LRH-1/beta-catenin complex
PDB Compounds: (A:) Catenin beta-1

SCOPe Domain Sequences for d3tx7a_:

Sequence, based on SEQRES records: (download)

>d3tx7a_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
latraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntnd
vetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqe
gakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvni
mrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrn
lsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggieal
vrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwpli
katvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrme
eivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkea
aeaieaegatapltellhsrnegvatyaaavlfr

Sequence, based on observed residues (ATOM records): (download)

>d3tx7a_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
latraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntnd
vetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqe
gakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvni
mrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrn
lsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggieal
vrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwpli
katvglirnlalcpanhaplreqgaiprlvqllvrahqdtqqfvegvrmeeivegctgal
hilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegat
apltellhsrnegvatyaaavlfr

SCOPe Domain Coordinates for d3tx7a_:

Click to download the PDB-style file with coordinates for d3tx7a_.
(The format of our PDB-style files is described here.)

Timeline for d3tx7a_: