SCOPe 2.05: Domain d3twwb_: 3tww B:

Lineage for d3twwb_ (3tww B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (18 PDB entries)

8. Domain d3twwb_: 3tww B: [185991]
   automated match to d1awcb_
   complexed with so4

Details for d3twwb_

PDB Entry: 3tww, 2 Å

PDB Description: Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human LNPEP (chimeric peptide)

PDB Compounds: (B:) tankyrase-2

SCOPe Domain Sequences for d3twwb_:

Sequence; same for both SEQRES and ATOM records:

>d3twwb_ d.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyll
qhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkye
icklllqhgadptkknrdgntpldlvkdgdtdiqdll

Timeline for d3twwb_:

• d3twwb_ first appeared in SCOPe 2.01
  
• d3twwb_ appears in SCOPe 2.04
  
• d3twwb_ is called d3twwb1 in SCOPe 2.06
  
• d3twwb_ appears in the current release, SCOPe 2.08, called d3twwb1