SCOPe 2.08: Domain d1gzaa_: 1gza A:

Lineage for d1gzaa_ (1gza A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Fungal peroxidase (ligninase) [88935] (3 species)

7. Species Arthromyces ramosus [TaxId:5451] [48118] (14 PDB entries)

8. Domain d1gzaa_: 1gza A: [18599]
   complexed with ca, hem, iod

Details for d1gzaa_

PDB Entry: 1gza, 2.06 Å

PDB Description: peroxidase

PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1gzaa_:

Sequence; same for both SEQRES and ATOM records:

>d1gzaa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

Timeline for d1gzaa_:

• d1gzaa_ first appeared (with stable ids) in SCOP 1.55, called d1gza__
  
• d1gzaa_ appears in SCOPe 2.07