Lineage for d1gzaa_ (1gza A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720218Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 2720219Species Arthromyces ramosus [TaxId:5451] [48118] (14 PDB entries)
  8. 2720233Domain d1gzaa_: 1gza A: [18599]
    complexed with ca, hem, iod

Details for d1gzaa_

PDB Entry: 1gza (more details), 2.06 Å

PDB Description: peroxidase
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1gzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzaa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiatasgplpslapap

SCOPe Domain Coordinates for d1gzaa_:

Click to download the PDB-style file with coordinates for d1gzaa_.
(The format of our PDB-style files is described here.)

Timeline for d1gzaa_: