Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.0: automated matches [191667] (1 protein) not a true family |
Protein automated matches [191267] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189837] (8 PDB entries) |
Domain d3twvd_: 3twv D: [185989] automated match to d1awcb_ complexed with edo, pe8, so4 |
PDB Entry: 3twv (more details), 2.3 Å
SCOPe Domain Sequences for d3twvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3twvd_ d.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllqh gadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyeic klllqhgadptkknrdgntpldlvkdgdtdiqdllr
Timeline for d3twvd_: