Lineage for d3twva_ (3twv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006665Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 3006666Protein automated matches [191267] (8 species)
    not a true protein
  7. 3006685Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)
  8. 3006724Domain d3twva_: 3twv A: [185986]
    automated match to d1awcb_
    complexed with edo, pe8, so4

Details for d3twva_

PDB Entry: 3twv (more details), 2.3 Å

PDB Description: crystal structure of arc4 from human tankyrase 2 in complex with peptide from human numa1 (chimeric peptide)
PDB Compounds: (A:) tankyrase-2

SCOPe Domain Sequences for d3twva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3twva_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllqhg
advhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyeick
lllqhgadptkknrdgntpldlvkdgdtdiqdllr

SCOPe Domain Coordinates for d3twva_:

Click to download the PDB-style file with coordinates for d3twva_.
(The format of our PDB-style files is described here.)

Timeline for d3twva_: