Lineage for d3twsb_ (3tws B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944478Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1944479Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1944620Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1944621Protein automated matches [191267] (5 species)
    not a true protein
  7. 1944634Species Human (Homo sapiens) [TaxId:9606] [189837] (18 PDB entries)
  8. 1944643Domain d3twsb_: 3tws B: [185978]
    automated match to d1awcb_
    complexed with edo, p6g, pe8, so4

Details for d3twsb_

PDB Entry: 3tws (more details), 1.7 Å

PDB Description: crystal structure of arc4 from human tankyrase 2 in complex with peptide from human terf1 (chimeric peptide)
PDB Compounds: (B:) tankyrase-2

SCOPe Domain Sequences for d3twsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3twsb_ d.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllq
hgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyei
cklllqhgadptkknrdgntpldlvkdgdtdiqdllr

SCOPe Domain Coordinates for d3twsb_:

Click to download the PDB-style file with coordinates for d3twsb_.
(The format of our PDB-style files is described here.)

Timeline for d3twsb_: