Lineage for d3twqa_ (3twq A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445942Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1445943Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1446071Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1446072Protein automated matches [191267] (3 species)
    not a true protein
  7. 1446078Species Human (Homo sapiens) [TaxId:9606] [189837] (14 PDB entries)
  8. 1446098Domain d3twqa_: 3twq A: [185971]
    automated match to d1awcb_
    complexed with gol, so4

Details for d3twqa_

PDB Entry: 3twq (more details), 2.15 Å

PDB Description: Crystal structure of ARC4 from human Tankyrase 2 (apo form)
PDB Compounds: (A:) tankyrase-2

SCOPe Domain Sequences for d3twqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3twqa_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgislgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvs
vveyllqhgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaa
akgkyeicklllqhgadptkknrdgntpldlvkdgdtdiqdllr

SCOPe Domain Coordinates for d3twqa_:

Click to download the PDB-style file with coordinates for d3twqa_.
(The format of our PDB-style files is described here.)

Timeline for d3twqa_: