Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries) Uniprot P01887 |
Domain d3tvmb_: 3tvm B: [185965] Other proteins in same PDB: d3tvma1, d3tvma2, d3tvmc1, d3tvmc2, d3tvmd1, d3tvmd2, d3tvme1, d3tvme2, d3tvmg1, d3tvmg2, d3tvmh1, d3tvmh2 automated match to d1p4lb_ complexed with 07p, cl, gol, nag |
PDB Entry: 3tvm (more details), 2.8 Å
SCOPe Domain Sequences for d3tvmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvmb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d3tvmb_: