Lineage for d3tv2a_ (3tv2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010373Protein automated matches [190147] (7 species)
    not a true protein
  7. 2010382Species Burkholderia pseudomallei [TaxId:320372] [189728] (1 PDB entry)
  8. 2010383Domain d3tv2a_: 3tv2 A: [185964]
    automated match to d1fuoa_
    complexed with na, unl

Details for d3tv2a_

PDB Entry: 3tv2 (more details), 2.1 Å

PDB Description: Structure of a class II fumarate hydratase from Burkholderia pseudomallei
PDB Compounds: (A:) Fumarate hydratase, class II

SCOPe Domain Sequences for d3tv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tv2a_ a.127.1.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
rmerdtfgeiavpaarlwgaqtqrslqnfkistekqspelihalalikraaaavnlelgv
laqdkanaivaaadeiiagrhadefplavwqtgsgtqtnmnlnevianrasellggerge
sravhpnddvnrgqssndvfptamhiaaaraivdhllpalrtlratldakaaafadivki
grthlqdatpltlgqefsgyvaqldqgirhveaalphlyelaqggtavgtglnahpkfaa
gvaaeigrltglpfvsapnkfevmaaadalvfahgalktvaaslmkiandirwlasgprc
glgelsipenepgssimpgkvnptqseavtmlccqvfgndvavnfggasgnfelnvfrpm
iahnvlqsvrlladgaqgfndhcavgiepnraridallneslmlvtalnphigydkaaqi
akkahkegttlkaaalalgyvtdaqfdewvrpehmvg

SCOPe Domain Coordinates for d3tv2a_:

Click to download the PDB-style file with coordinates for d3tv2a_.
(The format of our PDB-style files is described here.)

Timeline for d3tv2a_: